PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G2177
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 237aa    MW: 27323.9 Da    PI: 5.2291
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G2177genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding538e-17550348
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +WT+eEd+ll+++++++G g W++++   g++R++k+c++rw +yl
      Gh_A11G2177  5 AWTEEEDQLLKKCIERYGEGKWHRVPLLAGLNRCRKSCRLRWINYL 50
                     7*******************************************97 PP

2Myb_DNA-binding475.9e-1556100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg + ++E +l+++++k+lG++ W++Ia +++ gRt++++k++w+ +
      Gh_A11G2177  56 RGTFAEDEVQLIIKLHKLLGNK-WSLIAGRLP-GRTANDVKNYWNCH 100
                      78999*****************.*********.***********977 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.47150IPR017930Myb domain
SMARTSM007175.0E-14252IPR001005SANT/Myb domain
SuperFamilySSF466891.06E-27597IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-20557IPR009057Homeodomain-like
PfamPF002492.1E-15550IPR001005SANT/Myb domain
CDDcd001671.05E-11550No hitNo description
PROSITE profilePS5129424.82451105IPR017930Myb domain
SMARTSM007173.5E-1455103IPR001005SANT/Myb domain
PfamPF002493.0E-135698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2358105IPR009057Homeodomain-like
CDDcd001674.48E-1061101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGGVAWTEEE DQLLKKCIER YGEGKWHRVP LLAGLNRCRK SCRLRWINYL RPNIKRGTFA  60
EDEVQLIIKL HKLLGNKWSL IAGRLPGRTA NDVKNYWNCH LSKKLNNAQE TEEEYQNGMK  120
METLKPQPRC SAMTGSIKPR TQDHFAPKNQ PTIQESTMPT PFNFAEVVKQ QGHEIVKEEE  180
DIEEEAAVGV FFGDLATEDH QFGQLDEVNV LSSTNEGCSK WDWDDLMLDM DLWTDSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-22610610109B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.3690.0boll
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC4695830.0KC469583.1 Gossypium hirsutum clone 2 R2R3 MYB transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012492675.11e-156PREDICTED: transcription factor MYB113-like
SwissprotQ9FNV92e-58MY113_ARATH; Transcription factor MYB113
TrEMBLM9TFA01e-179M9TFA0_G
STRINGGLYMA18G41520.13e-81(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17352611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.11e-59myb domain protein 113